PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA22060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 356aa    MW: 40584.3 Da    PI: 7.3263
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA22060genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-3168121255
                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                prlrWtp+LH rF++av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Tp57577_TGAC_v2_mRNA22060  68 PRLRWTPDLHFRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 121
                                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.17964124IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2864122IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2268123IPR006447Myb domain, plants
SuperFamilySSF466892.33E-1468122IPR009057Homeodomain-like
PfamPF002495.9E-969120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MRKEETCGSI CSKTSVSINE NGCEISETNE DEESKQNNNG GISSSNSTIE ENSEKKPSVR  60
PYVRSKFPRL RWTPDLHFRF LHAVQRLGGQ ERATPKLVLQ LMNIKGLSIA HVKSHLQMYR  120
SKKVVDTNQV LGDHRLLVDN GDKNVYNLTQ LPMLQGYTPN QTSSNRCGYV DDSIAMYENM  180
VHMSSINESR ADFYGRRIER TNNNNINNME VHNIFQVNSS NFRELSTSKV HEPNDNFLSF  240
CGNESFRLSK NDDLQVQPRE QELMPNDNQV DLKTLKRKAS NMDLDLDLSL KLNSRIIGDD  300
HKNQGIIEDH HEVGSNLSLS LYSQSSYNLC KRKKEGQDDS KEQKKRVNIG LDLTI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1465541e-91AC146554.5 Medicago truncatula clone mth2-9l7, complete sequence.
GenBankCT9673021e-91CT967302.9 M.truncatula DNA sequence from clone MTH2-146M13 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003623331.20.0MYB-like transcription factor family protein
TrEMBLG7KSC80.0G7KSC8_MEDTR; MYB-like transcription factor family protein
STRINGGLYMA18G43550.21e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-49G2-like family protein